PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.I3LJK
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 645aa    MW: 74527 Da    PI: 10.1747
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.I3LJKgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.62.3e-1321112198
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  ffkv +++    ++ + lpkkf++ +g+    s  l l+ ++g +W+v     +++g++++++GWkeFv    L++g ++ F+++   + +  v++++
  Araip.I3LJK  21 FFKVILRKTLQDEN-FKLPKKFTRIYGSG--LSNPLYLKPPDGTEWRVDW--INQDGGILFKQGWKEFVAYYSLDDGYVLWFEYNI-GTSHIEVQICD 112
                  66777666555555.********999755..6667***************..9******************************973.44555888887 PP

2B341.23e-132743531799
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +++ kf++++  +++++  +++     + + vkliyr +s+  ++++GW+ F++a +L++gD+++Fkl++r++  l v+++r+
  Araip.I3LJK 274 YFSTKFFRKYFVNNPQNANIRFG---KKLFPVKLIYRPSSCDAFISAGWNFFARASKLQAGDVCLFKLVNRKDPVLDVHICRR 353
                  56677888885555666666644...499****************************************999999******98 PP

3B346.47.1e-153934681290
                  HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
           B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                  +++r  l+  f +++ +k++++  ++l+    + W v++iy+ +s+ +++++GW++F++a +L++gD++vF+l+++++ 
  Araip.I3LJK 393 RRSRPNLSAIFYRKYFKKNQQN--VKLQ-FGKKLWPVTIIYNPSSRNTFISAGWSSFARASKLEAGDVCVFELINEKDL 468
                  4556778888999997665555..5543.46699***************************************987443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.08E-1715114IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.0E-1715114IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.30720114IPR003340B3 DNA binding domain
CDDcd100176.74E-1120112No hitNo description
PfamPF023629.5E-1121112IPR003340B3 DNA binding domain
SMARTSM010192.0E-1021114IPR003340B3 DNA binding domain
SuperFamilySSF1019362.09E-11253353IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.2E-13255353IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0011259354IPR003340B3 DNA binding domain
PfamPF023621.5E-11274354IPR003340B3 DNA binding domain
CDDcd100171.18E-9274352No hitNo description
PROSITE profilePS508639.234300354IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.3E-20375474IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.26E-17376474IPR015300DNA-binding pseudobarrel domain
CDDcd100179.34E-15381472No hitNo description
SMARTSM010197.3E-9383470IPR003340B3 DNA binding domain
PfamPF023621.1E-12397468IPR003340B3 DNA binding domain
PROSITE profilePS5086310.997424477IPR003340B3 DNA binding domain
SMARTSM010190.017471550IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-13473548IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.1E-13475548IPR015300DNA-binding pseudobarrel domain
CDDcd100175.70E-7476548No hitNo description
PROSITE profilePS508639.996478550IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MVPSNCQQNK HSPSNSTVIR FFKVILRKTL QDENFKLPKK FTRIYGSGLS NPLYLKPPDG  60
TEWRVDWINQ DGGILFKQGW KEFVAYYSLD DGYVLWFEYN IGTSHIEVQI CDMSGLQIKY  120
PVNDQIKEHP PQHRGHPVKR PKEQQTIDVD NSPNTQNMRL NEGRQEKRLN EPMSGVGGQS  180
RKKLRAPVSS ASKGRQLESD TQIRESIKSK KKNHKMPVNQ DSNGKRNRKR KDSESSVRPC  240
LARPKSLKEA KFKWEKPSFI IKIKQLSQTR APCYFSTKFF RKYFVNNPQN ANIRFGKKLF  300
PVKLIYRPSS CDAFISAGWN FFARASKLQA GDVCLFKLVN RKDPVLDVHI CRRQRRESLS  360
KPVTHGIQLL KEVEELNSQN PSFMVKIKDS DPRRSRPNLS AIFYRKYFKK NQQNVKLQFG  420
KKLWPVTIIY NPSSRNTFIS AGWSSFARAS KLEAGDVCVF ELINEKDLFN VHKLTKKFSK  480
KYGDSLPNPV YLKPPDGTAW KIDWSLYDGV ILFENGWKEF ASYYSLDNGH MLYFEYNETS  540
NIEVRIFDII SGSEIDYPSL DHIGHDNSIE ILNELPPRGW PRKTEVSSPS TSKRLRSSVK  600
TGDVEKGPDE QNWMQCCKNE EASQSEETSL KMPTIQSARV DPDSM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209230KKKNHKMPVNQDSNGKRNRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016179783.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15597210
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.18e-22B3 family protein